Lineage for d4fl4e_ (4fl4 E:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1112569Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1112583Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) (S)
  5. 1112597Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins)
    Pfam PF00963
  6. 1112656Protein Scaffolding dockerin binding protein A, SdbA [141078] (1 species)
  7. 1112657Species Clostridium thermocellum [TaxId:1515] [141079] (3 PDB entries)
    Uniprot P71143 30-191! Uniprot P71143 30-195
  8. 1112661Domain d4fl4e_: 4fl4 E: [192431]
    complexed with ca, so4

Details for d4fl4e_

PDB Entry: 4fl4 (more details), 2.8 Å

PDB Description: Scaffoldin conformation and dynamics revealed by a ternary complex from the Clostridium thermocellum cellulosome
PDB Compounds: (E:) scaffolding dockerin binding protein a

SCOPe Domain Sequences for d4fl4e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fl4e_ b.2.2.2 (E:) Scaffolding dockerin binding protein A, SdbA {Clostridium thermocellum [TaxId: 1515]}
assielkfdrnkgevgdiligtvrinniknfagfqvnivydpkvlmavdpetgkeftsst
fppgrtvlknnaygpiqiadndpekgilnfalaysyiagyketgvaeesgiiakigfkil
qkkstavkfqdtlsmpgaisgtqlfdwdgevitgyeviqpdvlsl

SCOPe Domain Coordinates for d4fl4e_:

Click to download the PDB-style file with coordinates for d4fl4e_.
(The format of our PDB-style files is described here.)

Timeline for d4fl4e_: