Lineage for d4dgaa_ (4dga A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2416159Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 2416160Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 2416161Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 2416500Protein automated matches [190077] (21 species)
    not a true protein
  7. 2416590Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [189056] (4 PDB entries)
  8. 2416593Domain d4dgaa_: 4dga A: [192320]
    Other proteins in same PDB: d4dgac_, d4dgad_
    automated match to d1w8ma_

Details for d4dgaa_

PDB Entry: 4dga (more details), 1.9 Å

PDB Description: TRIMCyp cyclophilin domain from Macaca mulatta: HIV-1 CA(O-loop) complex
PDB Compounds: (A:) trimcyp

SCOPe Domain Sequences for d4dgaa_:

Sequence, based on SEQRES records: (download)

>d4dgaa_ b.62.1.1 (A:) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
cqggnfthhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktew
ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgql

Sequence, based on observed residues (ATOM records): (download)

>d4dgaa_ b.62.1.1 (A:) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
cqggnfthgtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktewld
gkhvvfgkvkegmniveamerfgsrngktskkitiadcgql

SCOPe Domain Coordinates for d4dgaa_:

Click to download the PDB-style file with coordinates for d4dgaa_.
(The format of our PDB-style files is described here.)

Timeline for d4dgaa_: