Lineage for d3un8g_ (3un8 G:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1934404Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1934405Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1934574Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1936395Protein automated matches [190144] (7 species)
    not a true protein
  7. 1936658Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (41 PDB entries)
  8. 1936688Domain d3un8g_: 3un8 G: [192183]
    Other proteins in same PDB: d3un8a_, d3un8e_, d3un8f_, d3un8i_, d3un8j_, d3un8k_, d3un8l_, d3un8m_, d3un8n_, d3un8o_, d3un8s_, d3un8t_, d3un8w_, d3un8x_, d3un8y_, d3un8z_
    automated match to d1jd22_
    complexed with 049

Details for d3un8g_

PDB Entry: 3un8 (more details), 2.7 Å

PDB Description: Yeast 20S proteasome in complex with PR-957 (epoxide)
PDB Compounds: (G:) Proteasome component C7-alpha

SCOPe Domain Sequences for d3un8g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3un8g_ d.153.1.4 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv
syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt
qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks
kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia
eqd

SCOPe Domain Coordinates for d3un8g_:

Click to download the PDB-style file with coordinates for d3un8g_.
(The format of our PDB-style files is described here.)

Timeline for d3un8g_: