Lineage for d3un8t_ (3un8 T:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1934404Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1934405Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1937404Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 1937405Protein automated matches [190509] (10 species)
    not a true protein
  7. 1937446Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (9 PDB entries)
  8. 1937448Domain d3un8t_: 3un8 T: [239872]
    Other proteins in same PDB: d3un8a_, d3un8b_, d3un8c_, d3un8d_, d3un8e_, d3un8g_, d3un8h_, d3un8i_, d3un8j_, d3un8k_, d3un8l_, d3un8m_, d3un8n_, d3un8o_, d3un8p_, d3un8q_, d3un8r_, d3un8s_, d3un8u_, d3un8v_, d3un8w_, d3un8x_, d3un8y_, d3un8z_
    automated match to d1irug_
    complexed with 049

Details for d3un8t_

PDB Entry: 3un8 (more details), 2.7 Å

PDB Description: Yeast 20S proteasome in complex with PR-957 (epoxide)
PDB Compounds: (T:) Proteasome component C1

SCOPe Domain Sequences for d3un8t_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3un8t_ d.153.1.0 (T:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gtgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqkn
vkiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqaht
lynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhp
eglsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaq
kein

SCOPe Domain Coordinates for d3un8t_:

Click to download the PDB-style file with coordinates for d3un8t_.
(The format of our PDB-style files is described here.)

Timeline for d3un8t_: