Lineage for d3tska1 (3tsk A:106-263)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2204982Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2204983Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2205557Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2205924Protein automated matches [190182] (1 species)
    not a true protein
  7. 2205925Species Human (Homo sapiens) [TaxId:9606] [186920] (47 PDB entries)
  8. 2205959Domain d3tska1: 3tsk A:106-263 [192160]
    Other proteins in same PDB: d3tska2
    automated match to d1os9a_
    complexed with ca, qeg, zn

Details for d3tska1

PDB Entry: 3tsk (more details), 2 Å

PDB Description: Human MMP12 in complex with L-glutamate motif inhibitor
PDB Compounds: (A:) Macrophage metalloelastase

SCOPe Domain Sequences for d3tska1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tska1 d.92.1.11 (A:106-263) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslyg

SCOPe Domain Coordinates for d3tska1:

Click to download the PDB-style file with coordinates for d3tska1.
(The format of our PDB-style files is described here.)

Timeline for d3tska1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3tska2