Lineage for d3rxga_ (3rxg A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1545310Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1545311Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1545555Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 1546437Protein Trypsin(ogen) [50515] (9 species)
  7. 1546455Species Cow (Bos taurus) [TaxId:9913] [50516] (393 PDB entries)
    Uniprot P00760
  8. 1546616Domain d3rxga_: 3rxg A: [191998]
    automated match to d1utna_
    complexed with ca, dms, gol, sz3

Details for d3rxga_

PDB Entry: 3rxg (more details), 1.7 Å

PDB Description: Crystal structure of Trypsin complexed with 4-aminocyclohexanol
PDB Compounds: (A:) cationic trypsin

SCOPe Domain Sequences for d3rxga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rxga_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

SCOPe Domain Coordinates for d3rxga_:

Click to download the PDB-style file with coordinates for d3rxga_.
(The format of our PDB-style files is described here.)

Timeline for d3rxga_: