Lineage for d1a37b_ (1a37 B:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1095602Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1096148Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
  5. 1096149Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)
  6. 1096164Protein zeta isoform [48449] (2 species)
  7. 1096165Species Cow (Bos taurus) [TaxId:9913] [48450] (3 PDB entries)
  8. 1096171Domain d1a37b_: 1a37 B: [19199]
    bound to ps-raf259 peptide

Details for d1a37b_

PDB Entry: 1a37 (more details), 3.6 Å

PDB Description: 14-3-3 protein zeta bound to ps-raf259 peptide
PDB Compounds: (B:) 14-3-3 protein zeta

SCOPe Domain Sequences for d1a37b_:

Sequence, based on SEQRES records: (download)

>d1a37b_ a.118.7.1 (B:) zeta isoform {Cow (Bos taurus) [TaxId: 9913]}
mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
vvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylk
mkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyye
ilnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlw

Sequence, based on observed residues (ATOM records): (download)

>d1a37b_ a.118.7.1 (B:) zeta isoform {Cow (Bos taurus) [TaxId: 9913]}
mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
vvssieqekkqqmareyrekietelrdicndvlsllekflipnaaeskvfylkmkgdyyr
ylaevaagddkkgivdqsqqayqeafeiskirlglalnfsvfyyacslaktafdeaiadd
stlimqllrdnltlw

SCOPe Domain Coordinates for d1a37b_:

Click to download the PDB-style file with coordinates for d1a37b_.
(The format of our PDB-style files is described here.)

Timeline for d1a37b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1a37a_