Lineage for d3q82a_ (3q82 A:)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1690252Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1690253Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1690254Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1690900Protein automated matches [190161] (19 species)
    not a true protein
  7. 1691064Species Staphylococcus aureus [TaxId:1280] [189852] (8 PDB entries)
  8. 1691073Domain d3q82a_: 3q82 A: [191935]
    automated match to d3q7va_
    complexed with gol, mer

Details for d3q82a_

PDB Entry: 3q82 (more details), 2.1 Å

PDB Description: Meropenem acylated BlaR1 sensor domain from Staphylococcus aureus
PDB Compounds: (A:) Beta-lactamase regulatory protein BlaR1

SCOPe Domain Sequences for d3q82a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q82a_ e.3.1.1 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
qsitdynykkplhndyqildkskifgsnsgsfvmysmaadayyiynekesrkryspnsty
kiylamfgldrhiindensrmswnhkhypfdawnkeqdlntamqnsvnwyferisdqipk
nytatqlkqlnygnknlgsyksywmedslkisnleqvivfknmmeqnnhfskkaknqlss
sllikknekyelygktgtgivngkynngwfvgyvitnhdkyyfathlsdgkpsgknaeli
sekilkemgvln

SCOPe Domain Coordinates for d3q82a_:

Click to download the PDB-style file with coordinates for d3q82a_.
(The format of our PDB-style files is described here.)

Timeline for d3q82a_: