SCOPe 2.02: Domain d3b2fa_: 3b2f A:

Lineage for d3b2fa_ (3b2f A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)

6. Protein 2Fe-2S ferredoxin [54294] (17 species)

7. Species Maize (Zea mays) [TaxId:4577] [54305] (3 PDB entries)

8. Domain d3b2fa_: 3b2f A: [191860]
   automated match to d1gaqb_
   complexed with fes

Details for d3b2fa_

PDB Entry: 3b2f, 1.7 Å

PDB Description: Maize Ferredoxin 1

PDB Compounds: (A:) Ferredoxin-1, chloroplastic

SCOPe Domain Sequences for d3b2fa_:

Sequence; same for both SEQRES and ATOM records:

>d3b2fa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Maize (Zea mays) [TaxId: 4577]}
atynvklitpegevelqvpddvyildqaeedgidlpyscragscsscagkvvsgsvdqsd
qsylddgqiadgwvltchayptsdvviethkeeelt

Timeline for d3b2fa_:

• d3b2fa_ is new in SCOPe 2.02-stable
  
• d3b2fa_ appears in SCOPe 2.03
  
• d3b2fa_ appears in the current release, SCOPe 2.08