SCOP 1.57: Domain d1dcqa1: 1dcq A:369-522

Lineage for d1dcqa1 (1dcq A:369-522)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (11 superfamilies)

4. Superfamily a.118.2: Ankyrin repeat [48403] (1 family)

5. Family a.118.2.1: Ankyrin repeat [48404] (9 proteins)

6. Protein Pyk2-associated protein beta [48423] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [48424] (1 PDB entry)

8. Domain d1dcqa1: 1dcq A:369-522 [19178]
   Other proteins in same PDB: d1dcqa2

Details for d1dcqa1

PDB Entry: 1dcq, 2.1 Å

PDB Description: crystal structure of the arf-gap domain and ankyrin repeats of papbeta.

SCOP Domain Sequences for d1dcqa1:

Sequence; same for both SEQRES and ATOM records:

>d1dcqa1 a.118.2.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus)}
adtaaklhslceavktrdifgllqayadgvdltekiplanghepdetalhlavrsvdrts
lhivdflvqnsgnldkqtgkgstalhyccltdnaeclklllrgkasieianesgetpldi
akrlkhehceelltqalsgrfnshvhveyewrll

Timeline for d1dcqa1:

• d1dcqa1 first appeared (with stable ids) in SCOP 1.55
  
• d1dcqa1 appears in SCOP 1.59
  
• d1dcqa1 appears in the current release, SCOPe 2.08