Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies) multiple repeats of beta(2)-alpha(2) motif |
Superfamily d.211.1: Ankyrin repeat [48403] (2 families) repeats organized in elongated structures |
Family d.211.1.1: Ankyrin repeat [48404] (21 proteins) this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain |
Protein Swi6 ankyrin-repeat fragment [48421] (1 species) interrupted by an insertion |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48422] (1 PDB entry) |
Domain d1sw6b_: 1sw6 B: [19177] applies to all domains of a family if the common domain is composed of a different number of small repeating units has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1sw6 (more details), 2.1 Å
SCOPe Domain Sequences for d1sw6b_:
Sequence, based on SEQRES records: (download)
>d1sw6b_ d.211.1.1 (B:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} gpiitfthdltsdflssplkimkalpspvvndneqkmkleaflqrllfpeiqemptslnn dssnrnseggssnqqqqhvsfdsllqevndafpntqlnlnipvdehgntplhwltsianl elvkhlvkhgsnrlygdnmgesclvkavksvnnydsgtfealldylypcliledsmnrti lhhiiitsgmtgcsaaakyyldilmgwivkkqnrpiqsgtnekeskpndkngerkdsile nldlkwiianmlnaqdsngdtclniaarlgnisivdalldygadpfianksglrpvdfga g
>d1sw6b_ d.211.1.1 (B:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} gpiitfthdltsdflssplkimkalpspvvndneqkmkleaflqrllsfdsllqevndaf pntqlnlnipvdehgntplhwltsianlelvkhlvkhgsnrlygdnmgesclvkavksvn nydsgtfealldylypcliledsmnrtilhhiiitsgmtgcsaaakyyldilmgwivkkq nrpiqsgkdsilenldlkwiianmlnaqdsngdtclniaarlgnisivdalldygadpfi anksglrpvdfgag
Timeline for d1sw6b_: