Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies) multiple repeats of beta(2)-alpha(2) motif |
Superfamily d.211.1: Ankyrin repeat [48403] (1 family) repeats organized in elongated structures |
Family d.211.1.1: Ankyrin repeat [48404] (17 proteins) this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain |
Protein Cell cycle inhibitor p16ink4A [48414] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [48415] (4 PDB entries) |
Domain d1bi7b_: 1bi7 B: [19166] Other proteins in same PDB: d1bi7a_ |
PDB Entry: 1bi7 (more details), 3.4 Å
SCOP Domain Sequences for d1bi7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} epsadwlataaargrveevralleaganpnapnsygrrpiqvmmmgsarvaellllhgae pncadpatltrpvhdaaregfldtlvvlhragarldvrdawgrlpvdlaeelghrdvary lraaa
Timeline for d1bi7b_: