SCOP 1.75: Domain d1bi7b_: 1bi7 B:

Lineage for d1bi7b_ (1bi7 B:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
   multiple repeats of beta(2)-alpha(2) motif

4. Superfamily d.211.1: Ankyrin repeat [48403] (1 family)
   repeats organized in elongated structures

5. Family d.211.1.1: Ankyrin repeat [48404] (17 proteins)
   this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain

6. Protein Cell cycle inhibitor p16ink4A [48414] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48415] (4 PDB entries)

8. Domain d1bi7b_: 1bi7 B: [19166]
   Other proteins in same PDB: d1bi7a_

Details for d1bi7b_

PDB Entry: 1bi7, 3.4 Å

PDB Description: mechanism of g1 cyclin dependent kinase inhibition from the structure of the cdk6-p16ink4a tumor suppressor complex

PDB Compounds: (B:) multiple tumor suppressor

SCOP Domain Sequences for d1bi7b_:

Sequence; same for both SEQRES and ATOM records:

>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]}
epsadwlataaargrveevralleaganpnapnsygrrpiqvmmmgsarvaellllhgae
pncadpatltrpvhdaaregfldtlvvlhragarldvrdawgrlpvdlaeelghrdvary
lraaa

Timeline for d1bi7b_:

• d1bi7b_ first appeared (with stable ids) in SCOP 1.55
  
• d1bi7b_ appears in SCOP 1.73
  
• d1bi7b_ appears in SCOPe 2.01
  
• d1bi7b_ appears in the current release, SCOPe 2.08