Lineage for d1bi7b_ (1bi7 B:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6046Fold a.118: alpha-alpha superhelix [48370] (11 superfamilies)
  4. 6122Superfamily a.118.2: Ankyrin repeat [48403] (1 family) (S)
  5. 6123Family a.118.2.1: Ankyrin repeat [48404] (9 proteins)
  6. 6127Protein Cell cycle inhibitor p16ink4A [48414] (2 species)
  7. 6128Species Human (Homo sapiens) [TaxId:9606] [48415] (4 PDB entries)
  8. 6129Domain d1bi7b_: 1bi7 B: [19166]
    Other proteins in same PDB: d1bi7a_

Details for d1bi7b_

PDB Entry: 1bi7 (more details), 3.4 Å

PDB Description: mechanism of g1 cyclin dependent kinase inhibition from the structure of the cdk6-p16ink4a tumor suppressor complex

SCOP Domain Sequences for d1bi7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bi7b_ a.118.2.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens)}
epsadwlataaargrveevralleaganpnapnsygrrpiqvmmmgsarvaellllhgae
pncadpatltrpvhdaaregfldtlvvlhragarldvrdawgrlpvdlaeelghrdvary
lraaa

SCOP Domain Coordinates for d1bi7b_:

Click to download the PDB-style file with coordinates for d1bi7b_.
(The format of our PDB-style files is described here.)

Timeline for d1bi7b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1bi7a_