Lineage for d1bi7b_ (1bi7 B:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.118: alpha-alpha superhelix [48370] (11 superfamilies) 
Superfamily a.118.2: Ankyrin repeat [48403] (1 family) 
Family a.118.2.1: Ankyrin repeat [48404] (9 proteins) 
Protein Cell cycle inhibitor p16ink4A [48414] (2 species) Species Human (Homo sapiens) [TaxId:9606] [48415] (4 PDB entries) 
Domain d1bi7b_: 1bi7 B: [19166]
Other proteins in same PDB: d1bi7a_
Details for d1bi7b_
PDB Entry: 1bi7 (more details), 3.4 Å
PDB Description: mechanism of g1 cyclin dependent kinase inhibition from the structure of the cdk6-p16ink4a tumor suppressor complex
SCOP Domain Sequences for d1bi7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bi7b_ a.118.2.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens)}
epsadwlataaargrveevralleaganpnapnsygrrpiqvmmmgsarvaellllhgae
pncadpatltrpvhdaaregfldtlvvlhragarldvrdawgrlpvdlaeelghrdvary
lraaa
SCOP Domain Coordinates for d1bi7b_:
Click to download the PDB-style file with coordinates for d1bi7b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bi7b_:
- d1bi7b_ appears in SCOP 1.57
- d1bi7b_ appears in the current release, SCOPe 2.07
View in 3D
