Lineage for d1bu9a_ (1bu9 A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 338069Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 338070Superfamily d.211.1: Ankyrin repeat [48403] (1 family) (S)
    repeats organized in elongated structures
  5. 338071Family d.211.1.1: Ankyrin repeat [48404] (12 proteins)
    this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain
  6. 338109Protein p18ink4C(ink6) [48412] (1 species)
  7. 338110Species Human (Homo sapiens) [TaxId:9606] [48413] (6 PDB entries)
  8. 338121Domain d1bu9a_: 1bu9 A: [19165]

Details for d1bu9a_

PDB Entry: 1bu9 (more details)

PDB Description: solution structure of p18-ink4c, 21 structures

SCOP Domain Sequences for d1bu9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bu9a_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens)}
maepwgnelasaaargdleqltsllqnnvnvnaqngfgrtalqvmklgnpeiarrlllrg
anpdlkdrtgfavihdaaragfldtlqtllefqadvniednegnlplhlaakeghlrvve
flvkhtasnvghrnhkgdtacdlarlygrnevvslmqangaggatnlq

SCOP Domain Coordinates for d1bu9a_:

Click to download the PDB-style file with coordinates for d1bu9a_.
(The format of our PDB-style files is described here.)

Timeline for d1bu9a_: