PDB entry 1bu9

View 1bu9 on RCSB PDB site
Description: solution structure of p18-ink4c, 21 structures
Deposited on 1998-09-15, released 1999-09-13
The last revision prior to the SCOP 1.65 freeze date was dated 1999-09-13, with a file datestamp of 1999-09-12.
Experiment type: NMR21
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1bu9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bu9A (A:)
    maepwgnelasaaargdleqltsllqnnvnvnaqngfgrtalqvmklgnpeiarrlllrg
    anpdlkdrtgfavihdaaragfldtlqtllefqadvniednegnlplhlaakeghlrvve
    flvkhtasnvghrnhkgdtacdlarlygrnevvslmqangaggatnlq