SCOP 1.67: Domain d1g3nf_: 1g3n F:

Lineage for d1g3nf_ (1g3n F:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
   multiple repeats of beta(2)-alpha(2) motif

4. Superfamily d.211.1: Ankyrin repeat [48403] (1 family)
   repeats organized in elongated structures

5. Family d.211.1.1: Ankyrin repeat [48404] (14 proteins)
   this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain

6. Protein p18ink4C(ink6) [48412] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48413] (6 PDB entries)

8. Domain d1g3nf_: 1g3n F: [19164]
   Other proteins in same PDB: d1g3na_, d1g3nc1, d1g3nc2, d1g3ne_, d1g3ng1, d1g3ng2

Details for d1g3nf_

PDB Entry: 1g3n, 2.9 Å

PDB Description: structure of a p18(ink4c)-cdk6-k-cyclin ternary complex

SCOP Domain Sequences for d1g3nf_:

Sequence; same for both SEQRES and ATOM records:

>d1g3nf_ d.211.1.1 (F:) p18ink4C(ink6) {Human (Homo sapiens)}
gnelasaaargdleqltsllqnnvnvnaqngfgrtalqvmklgnpeiarrlllrganpdl
kdrtgfavihdaaragfldtlqtllefqadvniednegnlplhlaakeghlrvveflvkh
tasnvghrnhkgdtacdlarlygrnevvslmqang

Timeline for d1g3nf_:

• d1g3nf_ first appeared (with stable ids) in SCOP 1.55
  
• d1g3nf_ appears in SCOP 1.65
  
• d1g3nf_ appears in SCOP 1.69
  
• d1g3nf_ appears in the current release, SCOPe 2.08