Lineage for d1g3nf_ (1g3n F:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.118: alpha-alpha superhelix [48370] (11 superfamilies) 
Superfamily a.118.2: Ankyrin repeat [48403] (1 family) 
Family a.118.2.1: Ankyrin repeat [48404] (9 proteins) 
Protein p18ink4C(ink6) [48412] (1 species) Species Human (Homo sapiens) [TaxId:9606] [48413] (3 PDB entries) 
Domain d1g3nf_: 1g3n F: [19164]
Other proteins in same PDB: d1g3na_, d1g3nc1, d1g3nc2, d1g3ne_, d1g3ng1, d1g3ng2
Details for d1g3nf_
PDB Entry: 1g3n (more details), 2.9 Å
PDB Description: structure of a p18(ink4c)-cdk6-k-cyclin ternary complex
SCOP Domain Sequences for d1g3nf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g3nf_ a.118.2.1 (F:) p18ink4C(ink6) {Human (Homo sapiens)}
gnelasaaargdleqltsllqnnvnvnaqngfgrtalqvmklgnpeiarrlllrganpdl
kdrtgfavihdaaragfldtlqtllefqadvniednegnlplhlaakeghlrvveflvkh
tasnvghrnhkgdtacdlarlygrnevvslmqang
SCOP Domain Coordinates for d1g3nf_:
Click to download the PDB-style file with coordinates for d1g3nf_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1g3nf_:
- d1g3nf_ appears in SCOP 1.57
- d1g3nf_ appears in the current release, SCOPe 2.08
View in 3D
