![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily) multihelical |
![]() | Superfamily a.116.1: GTPase activation domain, GAP [48350] (3 families) ![]() |
![]() | Family a.116.1.2: p120GAP domain-like [48360] (3 proteins) |
![]() | Protein p120GAP domain [48361] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48362] (2 PDB entries) |
![]() | Domain d1wq1g_: 1wq1 G: [19109] Other proteins in same PDB: d1wq1r_ complexed with af3, gdp, mg |
PDB Entry: 1wq1 (more details), 2.5 Å
SCOPe Domain Sequences for d1wq1g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wq1g_ a.116.1.2 (G:) p120GAP domain {Human (Homo sapiens) [TaxId: 9606]} mpeeeysefkelilqkelhvvyalshvcgqdrtllasillriflhekleslllctlndre ismedeattlfrattlastlmeqymkatatqfvhhalkdsilkimeskqscelspsklek nedvntnlthllnilselvekifmaseilpptlryiygclqksvqhkwptnttmrtrvvs gfvflrlicpailnprmfniisdspspiaartlilvaksvqnlanlvefgakepymegvn pfiksnkhrmimfldelgnvpelpdttehsrtdlsrdlaalheicvahsdelrtlsnerg aqqhvlkkllaitellqqkq
Timeline for d1wq1g_: