Lineage for d1wq1g_ (1wq1 G:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006251Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily)
    multihelical
  4. 2006252Superfamily a.116.1: GTPase activation domain, GAP [48350] (3 families) (S)
  5. 2006276Family a.116.1.2: p120GAP domain-like [48360] (2 protein domains)
  6. 2006280Protein p120GAP domain [48361] (1 species)
  7. 2006281Species Human (Homo sapiens) [TaxId:9606] [48362] (2 PDB entries)
  8. 2006283Domain d1wq1g_: 1wq1 G: [19109]
    Other proteins in same PDB: d1wq1r_
    complexed with af3, gdp, mg

Details for d1wq1g_

PDB Entry: 1wq1 (more details), 2.5 Å

PDB Description: ras-rasgap complex
PDB Compounds: (G:) p120gap

SCOPe Domain Sequences for d1wq1g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wq1g_ a.116.1.2 (G:) p120GAP domain {Human (Homo sapiens) [TaxId: 9606]}
mpeeeysefkelilqkelhvvyalshvcgqdrtllasillriflhekleslllctlndre
ismedeattlfrattlastlmeqymkatatqfvhhalkdsilkimeskqscelspsklek
nedvntnlthllnilselvekifmaseilpptlryiygclqksvqhkwptnttmrtrvvs
gfvflrlicpailnprmfniisdspspiaartlilvaksvqnlanlvefgakepymegvn
pfiksnkhrmimfldelgnvpelpdttehsrtdlsrdlaalheicvahsdelrtlsnerg
aqqhvlkkllaitellqqkq

SCOPe Domain Coordinates for d1wq1g_:

Click to download the PDB-style file with coordinates for d1wq1g_.
(The format of our PDB-style files is described here.)

Timeline for d1wq1g_: