SCOPe 2.04: Domain d1am4a_: 1am4 A:

Lineage for d1am4a_ (1am4 A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily)
   multihelical

4. Superfamily a.116.1: GTPase activation domain, GAP [48350] (3 families)

5. Family a.116.1.1: BCR-homology GTPase activation domain (BH-domain) [48351] (5 proteins)
   Pfam PF00620

6. Protein p50 RhoGAP domain [48352] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48353] (4 PDB entries)

8. Domain d1am4a_: 1am4 A: [19100]
   Other proteins in same PDB: d1am4d_, d1am4e_, d1am4f_
   complexed with gnp, mg

Details for d1am4a_

PDB Entry: 1am4, 2.7 Å

PDB Description: complex between cdc42hs.gmppnp and p50 rhogap (h. sapiens)

PDB Compounds: (A:) p50-rhogap

SCOPe Domain Sequences for d1am4a_:

Sequence; same for both SEQRES and ATOM records:

>d1am4a_ a.116.1.1 (A:) p50 RhoGAP domain {Human (Homo sapiens) [TaxId: 9606]}
prpplpnqqfgvslqhlqeknpeqepipivlretvaylqahalttegifrrsantqvvre
vqqkynmglpvdfdqynelhlpavilktflrelpeplltfdlyphvvgflnidesqrvpa
tlqvlqtlpeenyqvlrfltaflvqisahsdqnkmtntnlavvfgpnllwakdaaitlka
inpintftkflldhqgelf

Timeline for d1am4a_:

• d1am4a_ first appeared (with stable ids) in SCOP 1.55
  
• d1am4a_ appears in SCOPe 2.03
  
• d1am4a_ appears in SCOPe 2.05
  
• d1am4a_ appears in the current release, SCOPe 2.08