Class a: All alpha proteins [46456] (285 folds) |
Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily) multihelical |
Superfamily a.116.1: GTPase activation domain, GAP [48350] (3 families) |
Family a.116.1.1: BCR-homology GTPase activation domain (BH-domain) [48351] (5 proteins) Pfam PF00620 |
Protein p50 RhoGAP domain [48352] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [48353] (4 PDB entries) |
Domain d1am4a_: 1am4 A: [19100] Other proteins in same PDB: d1am4d_, d1am4e_, d1am4f_ complexed with gnp, mg |
PDB Entry: 1am4 (more details), 2.7 Å
SCOPe Domain Sequences for d1am4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1am4a_ a.116.1.1 (A:) p50 RhoGAP domain {Human (Homo sapiens) [TaxId: 9606]} prpplpnqqfgvslqhlqeknpeqepipivlretvaylqahalttegifrrsantqvvre vqqkynmglpvdfdqynelhlpavilktflrelpeplltfdlyphvvgflnidesqrvpa tlqvlqtlpeenyqvlrfltaflvqisahsdqnkmtntnlavvfgpnllwakdaaitlka inpintftkflldhqgelf
Timeline for d1am4a_: