Class a: All alpha proteins [46456] (285 folds) |
Fold a.115: A virus capsid protein alpha-helical domain [48344] (1 superfamily) multihelical; three-helical bundle in the core is surrounded by non-conserved helices |
Superfamily a.115.1: A virus capsid protein alpha-helical domain [48345] (3 families) this domain is interrupted by a jelly-roll beta-sandwich domain |
Family a.115.1.1: Orbivirus capsid [48346] (1 protein) |
Protein BTV vp7 [48347] (1 species) |
Species Bluetongue virus [TaxId:40051] [48348] (2 PDB entries) |
Domain d2btvj1: 2btv J:1-120,J:255-349 [19096] Other proteins in same PDB: d2btva_, d2btvb_, d2btvc2, d2btvd2, d2btve2, d2btvf2, d2btvg2, d2btvh2, d2btvi2, d2btvj2, d2btvp2, d2btvq2, d2btvr2, d2btvs2, d2btvt2 |
PDB Entry: 2btv (more details), 3.5 Å
SCOPe Domain Sequences for d2btvj1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2btvj1 a.115.1.1 (J:1-120,J:255-349) BTV vp7 {Bluetongue virus [TaxId: 40051]} mdtiaaraltvmracatlqearivleanvmeilgiainryngltlrgvtmrptslaqrne mffmcldmmlsaaginvgpispdytqhmatigvlatpeipftteaaneiarvtgetstwg Xktlnqypaltaeifnvysfrdhtwhglrtairnrttlpnmlppifppndrdsiltllll stladvytvlrpefamhgvnpmpgpltaaiaraayv
Timeline for d2btvj1:
View in 3D Domains from other chains: (mouse over for more information) d2btva_, d2btvb_, d2btvc1, d2btvc2, d2btvd1, d2btvd2, d2btve1, d2btve2, d2btvf1, d2btvf2, d2btvg1, d2btvg2, d2btvh1, d2btvh2, d2btvi1, d2btvi2, d2btvp1, d2btvp2, d2btvq1, d2btvq2, d2btvr1, d2btvr2, d2btvs1, d2btvs2, d2btvt1, d2btvt2 |