Class a: All alpha proteins [46456] (286 folds) |
Fold a.111: Acid phosphatase/Vanadium-dependent haloperoxidase [48316] (1 superfamily) multihelical; core: 5-helical bundle; binds cofactor at the beginning of third helix |
Superfamily a.111.1: Acid phosphatase/Vanadium-dependent haloperoxidase [48317] (3 families) |
Family a.111.1.1: Type 2 phosphatidic acid phosphatase, PAP2 [48318] (1 protein) |
Protein Bacterial acid phosphatase [48319] (1 species) |
Species Escherichia blattae [TaxId:563] [48320] (3 PDB entries) |
Domain d1d2ta_: 1d2t A: [19052] complexed with so4 |
PDB Entry: 1d2t (more details), 1.9 Å
SCOPe Domain Sequences for d1d2ta_:
Sequence, based on SEQRES records: (download)
>d1d2ta_ a.111.1.1 (A:) Bacterial acid phosphatase {Escherichia blattae [TaxId: 563]} gndtttkpdlyylknseainslallppppavgsiaflndqamyeqgrllrntergklaae danlssggvanafsgafgspitekdapalhklltnmiedagdlatrsakdhymrirpfaf ygvstcntteqdklskngsypsghtsigwatalvlaeinpqrqneilkrgyelgqsrvic gyhwqsdvdaarvvgsavvatlhtnpafqqqlqkakaefaqhqk
>d1d2ta_ a.111.1.1 (A:) Bacterial acid phosphatase {Escherichia blattae [TaxId: 563]} gndtttkpdlyylknseainslallppppavgsiaflndqamyeqgrllrntergklaae danlssggvanafsgafgspitekdapalhklltnmiedagdlatrsakdhymrirpfaf ygvstcntqdklskngsypsghtsigwatalvlaeinpqrqneilkrgyelgqsrvicgy hwqsdvdaarvvgsavvatlhtnpafqqqlqkakaefaqhqk
Timeline for d1d2ta_: