Lineage for d1fipb_ (1fip B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1477566Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1478251Family a.4.1.12: FIS-like [100918] (4 proteins)
  6. 1478256Protein FIS protein [48285] (2 species)
    includes N-terminal dimerisation subdomain
  7. 1478284Species Escherichia coli [TaxId:562] [48286] (16 PDB entries)
  8. 1478288Domain d1fipb_: 1fip B: [18981]
    mutant

Details for d1fipb_

PDB Entry: 1fip (more details), 1.9 Å

PDB Description: the structure of fis mutant pro61ala illustrates that the kink within the long alpha-helix is not due to the presence of the proline residue
PDB Compounds: (B:) factor for inversion stimulation (fis)

SCOPe Domain Sequences for d1fipb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fipb_ a.4.1.12 (B:) FIS protein {Escherichia coli [TaxId: 562]}
plrdsvkqalknyfaqlngqdvndlyelvlaeveqalldmvmqytrgnqtraalmmginr
gtlrkklkkygmn

SCOPe Domain Coordinates for d1fipb_:

Click to download the PDB-style file with coordinates for d1fipb_.
(The format of our PDB-style files is described here.)

Timeline for d1fipb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1fipa_