![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
![]() | Superfamily a.104.1: Cytochrome P450 [48264] (2 families) ![]() |
![]() | Family a.104.1.1: Cytochrome P450 [48265] (23 proteins) |
![]() | Protein Cytochrome P450-NOR, nitric reductase [48270] (1 species) |
![]() | Species Fungus (Fusarium oxysporum) [TaxId:5507] [48271] (18 PDB entries) Uniprot P23295 |
![]() | Domain d1geda_: 1ged A: [18964] complexed with br, hem |
PDB Entry: 1ged (more details), 2 Å
SCOPe Domain Sequences for d1geda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1geda_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} apsfpfsrasgpeppaefaklratnpvsqvklfdgslawlvtkhkdvcfvatseklskvr trqgfpelsasgkqaakakptfvdmdppehmhqrsmveptftpeavknlqpyiqrtvddl leqmkqkgcangpvdlvkefalpvpsyiiytllgvpfndleyltqqnairtngsstarea saanqelldylailveqrlvepkddiisklcteqvkpgnidksdavqiaflllvagnatm vnmialgvatlaqhpdqlaqlkanpslapqfveelcryhtasalaikrtakedvmigdkl vranegiiasnqsanrdeevfenpdefnmnrkwppqdplgfgfgdhrciaehlakaeltt vfstlyqkfpdlkvavplgkinytplnrdvgivdlpvif
Timeline for d1geda_: