Lineage for d4cp4__ (4cp4 -)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 359341Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 359342Superfamily a.104.1: Cytochrome P450 [48264] (1 family) (S)
  5. 359343Family a.104.1.1: Cytochrome P450 [48265] (19 proteins)
  6. 359407Protein Cytochrome P450-CAM [48266] (1 species)
  7. 359408Species Pseudomonas putida [TaxId:303] [48267] (42 PDB entries)
  8. 359438Domain d4cp4__: 4cp4 - [18928]
    complexed with cam, hem

Details for d4cp4__

PDB Entry: 4cp4 (more details), 2.1 Å

PDB Description: crystal structure of the cytochrome p450-cam active site mutant thr252ala

SCOP Domain Sequences for d4cp4__:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cp4__ a.104.1.1 (-) Cytochrome P450-CAM {Pseudomonas putida}
nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
lireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen
riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
ldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg
vqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiiv
tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav

SCOP Domain Coordinates for d4cp4__:

Click to download the PDB-style file with coordinates for d4cp4__.
(The format of our PDB-style files is described here.)

Timeline for d4cp4__: