| Class a: All alpha proteins [46456] (202 folds) |
| Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (1 family) ![]() |
| Family a.104.1.1: Cytochrome P450 [48265] (19 proteins) |
| Protein Cytochrome P450-CAM [48266] (1 species) |
| Species Pseudomonas putida [TaxId:303] [48267] (42 PDB entries) |
| Domain d1geka_: 1gek A: [18915] complexed with hem, nbn |
PDB Entry: 1gek (more details), 1.7 Å
SCOP Domain Sequences for d1geka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1geka_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida}
anlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrg
qlireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdkle
nriqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpd
gsmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvg
gldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefh
gvqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreii
vtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
Timeline for d1geka_: