Lineage for d1phe__ (1phe -)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 359341Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 359342Superfamily a.104.1: Cytochrome P450 [48264] (1 family) (S)
  5. 359343Family a.104.1.1: Cytochrome P450 [48265] (19 proteins)
  6. 359407Protein Cytochrome P450-CAM [48266] (1 species)
  7. 359408Species Pseudomonas putida [TaxId:303] [48267] (42 PDB entries)
  8. 359419Domain d1phe__: 1phe - [18912]
    complexed with hem, pim, so4

Details for d1phe__

PDB Entry: 1phe (more details), 1.6 Å

PDB Description: crystal structures of metyrapone-and phenylimidazole-inhibited complexes of cytochrome p450-cam

SCOP Domain Sequences for d1phe__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1phe__ a.104.1.1 (-) Cytochrome P450-CAM {Pseudomonas putida}
nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
lireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen
riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
ldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg
vqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiiv
tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav

SCOP Domain Coordinates for d1phe__:

Click to download the PDB-style file with coordinates for d1phe__.
(The format of our PDB-style files is described here.)

Timeline for d1phe__: