Lineage for d1qmqa_ (1qmq A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 284545Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 284546Superfamily a.104.1: Cytochrome P450 [48264] (1 family) (S)
  5. 284547Family a.104.1.1: Cytochrome P450 [48265] (14 proteins)
  6. 284607Protein Cytochrome P450-CAM [48266] (1 species)
  7. 284608Species Pseudomonas putida [TaxId:303] [48267] (40 PDB entries)
  8. 284613Domain d1qmqa_: 1qmq A: [18907]
    complexed with act, drb, hem, lrb; mutant

Details for d1qmqa_

PDB Entry: 1qmq (more details), 1.55 Å

PDB Description: optical detection of cytochrome p450 by sensitizer-linked substrates

SCOP Domain Sequences for d1qmqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qmqa_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida}
anlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrg
qlireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdkle
nriqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpd
gsmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvg
gldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefh
gvqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclgqhlarreii
vtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav

SCOP Domain Coordinates for d1qmqa_:

Click to download the PDB-style file with coordinates for d1qmqa_.
(The format of our PDB-style files is described here.)

Timeline for d1qmqa_: