Lineage for d1qmqa_ (1qmq A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005161Protein Cytochrome P450-CAM [48266] (1 species)
  7. 2005162Species Pseudomonas putida [TaxId:303] [48267] (115 PDB entries)
    Uniprot P00183
  8. 2005181Domain d1qmqa_: 1qmq A: [18907]
    complexed with act, drb, hem, lrb

Details for d1qmqa_

PDB Entry: 1qmq (more details), 1.55 Å

PDB Description: Optical detection of cytochrome P450 by sensitizer-linked substrates
PDB Compounds: (A:) cytochrome p450

SCOPe Domain Sequences for d1qmqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qmqa_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]}
anlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrg
qlireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdkle
nriqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpd
gsmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvg
gldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefh
gvqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclgqhlarreii
vtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav

SCOPe Domain Coordinates for d1qmqa_:

Click to download the PDB-style file with coordinates for d1qmqa_.
(The format of our PDB-style files is described here.)

Timeline for d1qmqa_: