SCOP 1.71: Domain d4ctsb_: 4cts B:

Lineage for d4ctsb_ (4cts B:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.103: Citrate synthase [48255] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.103.1: Citrate synthase [48256] (1 family)

5. Family a.103.1.1: Citrate synthase [48257] (1 protein)
   duplication: large domain consists of two structural repeats
   the second repeat is interrupted by the small domain

6. Protein Citrate synthase [48258] (7 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [48260] (3 PDB entries)

8. Domain d4ctsb_: 4cts B: [18899]
   complexed with oaa

Details for d4ctsb_

PDB Entry: 4cts, 2.9 Å

PDB Description: crystal structure analysis and molecular model of a complex of citrate synthase with oxaloacetate and s-acetonyl-coenzyme a

SCOP Domain Sequences for d4ctsb_:

Sequence; same for both SEQRES and ATOM records:

>d4ctsb_ a.103.1.1 (B:) Citrate synthase {Pig (Sus scrofa)}
asstnlkdiladlipkeqariktfrqqhgntvvgqitvdmmyggmrgmkglvyetsvldp
degirfrgysipecqkmlpkakggeeplpeglfwllvtgqipteeqvswlskewakraal
pshvvtmldnfptnlhpmsqlsaaitalnsesnfarayaegihrtkyweliyedcmdlia
klpcvaakiyrnlyregssigaidskldwshnftnmlgytdaqftelmrlyltihsdheg
gnvsahtshlvgsalsdpylsfaaamnglagplhglanqevlvwltqlqkevgkdvsdek
lrdyiwntlnsgrvvpgyghavlrktdprytcqrefalkhlphdpmfklvaqlykivpnv
lleqgkaknpwpnvdahsgvllqyygmtemnyytvlfgvsralgvlaqliwsralgfple
rpksmstdgliklvdsk

Timeline for d4ctsb_:

• d4ctsb_ first appeared (with stable ids) in SCOP 1.55
  
• d4ctsb_ appears in SCOP 1.69
  
• d4ctsb_ appears in SCOP 1.73
  
• d4ctsb_ appears in the current release, SCOPe 2.08