![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.103: Citrate synthase [48255] (1 superfamily) multihelical; consists of two all-alpha domains |
![]() | Superfamily a.103.1: Citrate synthase [48256] (2 families) ![]() |
![]() | Family a.103.1.1: Citrate synthase [48257] (2 proteins) duplication: large domain consists of two structural repeats the second repeat is interrupted by the small domain automatically mapped to Pfam PF00285 |
![]() | Protein Citrate synthase [48258] (7 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [48260] (4 PDB entries) |
![]() | Domain d4ctsb_: 4cts B: [18899] complexed with oaa |
PDB Entry: 4cts (more details), 2.9 Å
SCOPe Domain Sequences for d4ctsb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ctsb_ a.103.1.1 (B:) Citrate synthase {Pig (Sus scrofa) [TaxId: 9823]} asstnlkdiladlipkeqariktfrqqhgntvvgqitvdmmyggmrgmkglvyetsvldp degirfrgysipecqkmlpkakggeeplpeglfwllvtgqipteeqvswlskewakraal pshvvtmldnfptnlhpmsqlsaaitalnsesnfarayaegihrtkyweliyedcmdlia klpcvaakiyrnlyregssigaidskldwshnftnmlgytdaqftelmrlyltihsdheg gnvsahtshlvgsalsdpylsfaaamnglagplhglanqevlvwltqlqkevgkdvsdek lrdyiwntlnsgrvvpgyghavlrktdprytcqrefalkhlphdpmfklvaqlykivpnv lleqgkaknpwpnvdahsgvllqyygmtemnyytvlfgvsralgvlaqliwsralgfple rpksmstdgliklvdsk
Timeline for d4ctsb_: