Class a: All alpha proteins [46456] (171 folds) |
Fold a.103: Citrate synthase [48255] (1 superfamily) multihelical; consists of two all-alpha domains |
Superfamily a.103.1: Citrate synthase [48256] (1 family) |
Family a.103.1.1: Citrate synthase [48257] (1 protein) duplication: large domain consists of two structural repeats the second repeat is interrupted by the small domain |
Protein Citrate synthase [48258] (6 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [48259] (14 PDB entries) |
Domain d6cscb_: 6csc B: [18893] complexed with cit, cof |
PDB Entry: 6csc (more details), 2.25 Å
SCOP Domain Sequences for d6cscb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6cscb_ a.103.1.1 (B:) Citrate synthase {Chicken (Gallus gallus)} tnlkdvlaslipkeqariktfrqqhgntavgqitvdmsyggmrgmkgliyetsvldpdeg irfrgfsipecqkllpkagggeeplpeglfwllvtgqiptpeqvswvskewakraalpsh vvtmldnfptnlhpmsqlsaaitalnsesnfarayaeginrtkywefvyedamdliaklp cvaakiyrnlyragssigaidskldwshnftnmlgytdpqftelmrlyltihsdheggnv sahtshlvgsalsdpylsfaaamnglagplhglanqevllwlsqlqkdlgadasdeklrd yiwntlnsgrvvpgyghavlrktdprytcqrefalkhlpsdpmfklvaqlykivpnvlle qgkaknpwpnvdahsgvllqyygmtemnyytvlfgvsralgvlaqliwsralgfplerpk smstagleklsagg
Timeline for d6cscb_: