SCOP 1.73: Domain d1cssa_: 1css A:

Lineage for d1cssa_ (1css A:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.103: Citrate synthase [48255] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.103.1: Citrate synthase [48256] (1 family)

5. Family a.103.1.1: Citrate synthase [48257] (1 protein)
   duplication: large domain consists of two structural repeats
   the second repeat is interrupted by the small domain

6. Protein Citrate synthase [48258] (7 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [48259] (14 PDB entries)

8. Domain d1cssa_: 1css A: [18882]
   complexed with fcx, oaa

Details for d1cssa_

PDB Entry: 1css, 1.7 Å

PDB Description: alpha-fluoro acid and alpha-fluoro amide analogs of acetyl-coa as inhibitors of of citrate synthase: effect of pka matching on binding affinity and hydrogen bond length

PDB Compounds: (A:) citrate synthase

SCOP Domain Sequences for d1cssa_:

Sequence; same for both SEQRES and ATOM records:

>d1cssa_ a.103.1.1 (A:) Citrate synthase {Chicken (Gallus gallus) [TaxId: 9031]}
stnlkdvlaslipkeqariktfrqqhgntavgqitvdmsyggmrgmkgliyetsvldpde
girfrgfsipecqkllpkagggeeplpeglfwllvtgqiptpeqvswvskewakraalps
hvvtmldnfptnlhpmsqlsaaitalnsesnfarayaeginrtkywefvyedamdliakl
pcvaakiyrnlyragssigaidskldwshnftnmlgytdpqftelmrlyltihsdheggn
vsahtshlvgsalsdpylsfaaamnglagplhglanqevllwlsqlqkdlgadasdeklr
dyiwntlnsgrvvpgyghavlrktdprytcqrefalkhlpsdpmfklvaqlykivpnvll
eqgkaknpwpnvdahsgvllqyygmtemnyytvlfgvsralgvlaqliwsralgfplerp
ksmstagleklsagg

Timeline for d1cssa_:

• d1cssa_ first appeared (with stable ids) in SCOP 1.55, called d1css__
  
• d1cssa_ was called d1css__ in SCOP 1.71
  
• d1cssa_ appears in SCOP 1.75
  
• d1cssa_ appears in the current release, SCOPe 2.08