Lineage for d1css__ (1css -)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 542199Fold a.103: Citrate synthase [48255] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 542200Superfamily a.103.1: Citrate synthase [48256] (1 family) (S)
  5. 542201Family a.103.1.1: Citrate synthase [48257] (1 protein)
    duplication: large domain consists of two structural repeats
    the second repeat is interrupted by the small domain
  6. 542202Protein Citrate synthase [48258] (7 species)
  7. 542213Species Chicken (Gallus gallus) [TaxId:9031] [48259] (14 PDB entries)
  8. 542216Domain d1css__: 1css - [18882]
    complexed with fcx, oaa

Details for d1css__

PDB Entry: 1css (more details), 1.7 Å

PDB Description: alpha-fluoro acid and alpha-fluoro amide analogs of acetyl-coa as inhibitors of of citrate synthase: effect of pka matching on binding affinity and hydrogen bond length

SCOP Domain Sequences for d1css__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1css__ a.103.1.1 (-) Citrate synthase {Chicken (Gallus gallus)}
stnlkdvlaslipkeqariktfrqqhgntavgqitvdmsyggmrgmkgliyetsvldpde
girfrgfsipecqkllpkagggeeplpeglfwllvtgqiptpeqvswvskewakraalps
hvvtmldnfptnlhpmsqlsaaitalnsesnfarayaeginrtkywefvyedamdliakl
pcvaakiyrnlyragssigaidskldwshnftnmlgytdpqftelmrlyltihsdheggn
vsahtshlvgsalsdpylsfaaamnglagplhglanqevllwlsqlqkdlgadasdeklr
dyiwntlnsgrvvpgyghavlrktdprytcqrefalkhlpsdpmfklvaqlykivpnvll
eqgkaknpwpnvdahsgvllqyygmtemnyytvlfgvsralgvlaqliwsralgfplerp
ksmstagleklsagg

SCOP Domain Coordinates for d1css__:

Click to download the PDB-style file with coordinates for d1css__.
(The format of our PDB-style files is described here.)

Timeline for d1css__: