Lineage for d1csia_ (1csi A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1743620Fold a.103: Citrate synthase [48255] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 1743621Superfamily a.103.1: Citrate synthase [48256] (2 families) (S)
  5. 1743622Family a.103.1.1: Citrate synthase [48257] (2 proteins)
    duplication: large domain consists of two structural repeats
    the second repeat is interrupted by the small domain
    automatically mapped to Pfam PF00285
  6. 1743623Protein Citrate synthase [48258] (7 species)
  7. 1743626Species Chicken (Gallus gallus) [TaxId:9031] [48259] (14 PDB entries)
  8. 1743628Domain d1csia_: 1csi A: [18881]
    complexed with cmx, oaa

Details for d1csia_

PDB Entry: 1csi (more details), 1.7 Å

PDB Description: a very short hydrogen bond provides only moderate stabilization of an enzyme: inhibitor complex of citrate synthase
PDB Compounds: (A:) citrate synthase

SCOPe Domain Sequences for d1csia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1csia_ a.103.1.1 (A:) Citrate synthase {Chicken (Gallus gallus) [TaxId: 9031]}
stnlkdvlaslipkeqariktfrqqhgntavgqitvdmsyggmrgmkgliyetsvldpde
girfrgfsipecqkllpkagggeeplpeglfwllvtgqiptpeqvswvskewakraalps
hvvtmldnfptnlhpmsqlsaaitalnsesnfarayaeginrtkywefvyedamdliakl
pcvaakiyrnlyragssigaidskldwshnftnmlgytdpqftelmrlyltihsdheggn
vsahtshlvgsalsdpylsfaaamnglagplhglanqevllwlsqlqkdlgadasdeklr
dyiwntlnsgrvvpgyghavlrktdprytcqrefalkhlpsdpmfklvaqlykivpnvll
eqgkaknpwpnvdahsgvllqyygmtemnyytvlfgvsralgvlaqliwsralgfplerp
ksmstagleklsagg

SCOPe Domain Coordinates for d1csia_:

Click to download the PDB-style file with coordinates for d1csia_.
(The format of our PDB-style files is described here.)

Timeline for d1csia_: