Lineage for d1utg__ (1utg -)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 50008Fold a.101: Uteroglobin-like [48200] (1 superfamily)
  4. 50009Superfamily a.101.1: Uteroglobin-like [48201] (1 family) (S)
  5. 50010Family a.101.1.1: Uteroglobin-like [48202] (2 proteins)
  6. 50016Protein Uteroglobin [48203] (1 species)
  7. 50017Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [48204] (2 PDB entries)
  8. 50018Domain d1utg__: 1utg - [18813]

Details for d1utg__

PDB Entry: 1utg (more details), 1.34 Å

PDB Description: refinement of the c2221 crystal form of oxidized uteroglobin at 1.34 angstroms resolution

SCOP Domain Sequences for d1utg__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1utg__ a.101.1.1 (-) Uteroglobin {Rabbit (Oryctolagus cuniculus)}
gicprfahvienlllgtpssyetslkefepddtmkdagmqmkkvldslpqttrenimklt
ekivksplcm

SCOP Domain Coordinates for d1utg__:

Click to download the PDB-style file with coordinates for d1utg__.
(The format of our PDB-style files is described here.)

Timeline for d1utg__: