| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.101: Uteroglobin-like [48200] (1 superfamily) multihelical |
Superfamily a.101.1: Uteroglobin-like [48201] (2 families) ![]() disulfide-linked dimer of two identical chains, 4 helices in each |
| Family a.101.1.1: Uteroglobin-like [48202] (4 proteins) |
| Protein Uteroglobin [48203] (1 species) |
| Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [48204] (2 PDB entries) |
| Domain d1utga_: 1utg A: [18813] |
PDB Entry: 1utg (more details), 1.34 Å
SCOPe Domain Sequences for d1utga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1utga_ a.101.1.1 (A:) Uteroglobin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
gicprfahvienlllgtpssyetslkefepddtmkdagmqmkkvldslpqttrenimklt
ekivksplcm
Timeline for d1utga_: