Lineage for d3hdha1 (3hdh A:204-302)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 99951Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
  4. 99952Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (7 families) (S)
  5. 99975Family a.100.1.3: Short chain L-3-hydroxyacyl CoA dehydrogenase [48187] (1 protein)
  6. 99976Protein Short chain L-3-hydroxyacyl CoA dehydrogenase [48188] (2 species)
  7. 99992Species Pig (Sus scrofa) [TaxId:9823] [48190] (1 PDB entry)
  8. 99993Domain d3hdha1: 3hdh A:204-302 [18805]
    Other proteins in same PDB: d3hdha2, d3hdhb2, d3hdhc2

Details for d3hdha1

PDB Entry: 3hdh (more details), 2.8 Å

PDB Description: pig heart short chain l-3-hydroxyacyl coa dehydrogenase revisited: sequence analysis and crystal structure determination

SCOP Domain Sequences for d3hdha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hdha1 a.100.1.3 (A:204-302) Short chain L-3-hydroxyacyl CoA dehydrogenase {Pig (Sus scrofa)}
gfivnrllvpylieavrlyergdaskedidtamklgagypmgpfelldyvgldttkfiid
gwhemdsqnplfqpspamnklvaenkfgkktgegfykyk

SCOP Domain Coordinates for d3hdha1:

Click to download the PDB-style file with coordinates for d3hdha1.
(The format of our PDB-style files is described here.)

Timeline for d3hdha1: