Lineage for d1f12a1 (1f12 A:204-304)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 99951Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
  4. 99952Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (7 families) (S)
  5. 99975Family a.100.1.3: Short chain L-3-hydroxyacyl CoA dehydrogenase [48187] (1 protein)
  6. 99976Protein Short chain L-3-hydroxyacyl CoA dehydrogenase [48188] (2 species)
  7. 99977Species Human (Homo sapiens) [TaxId:9606] [48189] (7 PDB entries)
  8. 99990Domain d1f12a1: 1f12 A:204-304 [18803]
    Other proteins in same PDB: d1f12a2, d1f12b2

Details for d1f12a1

PDB Entry: 1f12 (more details), 2.4 Å

PDB Description: l-3-hydroxyacyl-coa dehydrogenase complexed with 3-hydroxybutyryl-coa

SCOP Domain Sequences for d1f12a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f12a1 a.100.1.3 (A:204-304) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens)}
gfivnrllvpylmeairlyergdaskedidtamklgagypmgpfelldyvgldttkfivd
gwhemdaenplhqpspslnklvaenkfgkktgegfykykle

SCOP Domain Coordinates for d1f12a1:

Click to download the PDB-style file with coordinates for d1f12a1.
(The format of our PDB-style files is described here.)

Timeline for d1f12a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f12a2