Class a: All alpha proteins [46456] (202 folds) |
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (9 families) N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
Family a.100.1.3: Short chain L-3-hydroxyacyl CoA dehydrogenase [48187] (1 protein) |
Protein Short chain L-3-hydroxyacyl CoA dehydrogenase [48188] (2 species) Dimer of 5-helical motifs; similar to duplicated motifs of 6PGD and KARI |
Species Human (Homo sapiens) [TaxId:9606] [48189] (11 PDB entries) |
Domain d1f17a1: 1f17 A:204-304 [18797] Other proteins in same PDB: d1f17a2, d1f17b2 |
PDB Entry: 1f17 (more details), 2.3 Å
SCOP Domain Sequences for d1f17a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f17a1 a.100.1.3 (A:204-304) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens)} gfivnrllvpylmeairlyergdaskedidtamklgagypmgpfelldyvgldttkfivd gwhemdaenplhqpspslnklvaenkfgkktgegfykykle
Timeline for d1f17a1: