Class a: All alpha proteins [46456] (258 folds) |
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (12 families) N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
Family a.100.1.1: Hydroxyisobutyrate and 6-phosphogluconate dehydrogenase domain [48180] (2 proteins) Hydroxyisobutyrate dehydrogenase domain is similar to one structural repeat in the 6-phosphogluconate dehydrogenase domain |
Protein 6-phosphogluconate dehydrogenase (6PGD) [48181] (2 species) duplication; contains two structural repeats |
Species Sheep (Ovis orientalis aries) [TaxId:9940] [48182] (5 PDB entries) |
Domain d2pgda1: 2pgd A:177-473 [18778] Other proteins in same PDB: d2pgda2 complexed with so4 |
PDB Entry: 2pgd (more details), 2 Å
SCOP Domain Sequences for d2pgda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pgda1 a.100.1.1 (A:177-473) 6-phosphogluconate dehydrogenase (6PGD) {Sheep (Ovis orientalis aries) [TaxId: 9940]} gaghfvkmvhngieygdmqliceayhlmkdvlglghkemakafeewnkteldsflieita silkfqdadgkhllpkirdsagqkgtgkwtaisaleygvpvtligeavfarclsslkder iqaskklkgpqnipfegdkksfledirkalyaskiisyaqgfmllrqaatefgwtlnygg ialmwrggciirsvflgkikdafdrnpglqnlllddffksavencqdswrraistgvqag ipmpcfttalsfydgyrhamlpanliqaqrdyfgahtyellakpgqfihtnwtghgg
Timeline for d2pgda1: