Lineage for d1dnpb1 (1dnp B:201-469)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 358760Fold a.99: Cryptochrome/photolyase FAD-binding domain [48172] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
  4. 358761Superfamily a.99.1: Cryptochrome/photolyase FAD-binding domain [48173] (1 family) (S)
  5. 358762Family a.99.1.1: Cryptochrome/photolyase FAD-binding domain [48174] (2 proteins)
  6. 358763Protein C-terminal domain of DNA photolyase [48175] (3 species)
    N-terminal domain is alpha/beta and binds a light-harvesting cofactor
  7. 358771Species Escherichia coli [TaxId:562] [48176] (1 PDB entry)
  8. 358773Domain d1dnpb1: 1dnp B:201-469 [18776]
    Other proteins in same PDB: d1dnpa2, d1dnpb2
    complexed with fad, mhf

Details for d1dnpb1

PDB Entry: 1dnp (more details), 2.3 Å

PDB Description: structure of deoxyribodipyrimidine photolyase

SCOP Domain Sequences for d1dnpb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dnpb1 a.99.1.1 (B:201-469) C-terminal domain of DNA photolyase {Escherichia coli}
pveekaaiaqlrqfcqngageyeqqrdfpavegtsrlsaslatgglsprqclhrllaeqp
qaldggagsvwlneliwrefyrhlityhpslckhrpfiawtdrvqwqsnpahlqawqegk
tgypivdaamrqlnstgwmhnrlrmitasflvkdllidwregeryfmsqlidgdlaanng
gwqwaastgtdaapyfrifnpttqgekfdhegefirqwlpelrdvpgkvvhepwkwaqka
gvtldypqpivehkearvqtlaayeaark

SCOP Domain Coordinates for d1dnpb1:

Click to download the PDB-style file with coordinates for d1dnpb1.
(The format of our PDB-style files is described here.)

Timeline for d1dnpb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dnpb2