Class a: All alpha proteins [46456] (202 folds) |
Fold a.98: R1 subunit of ribonucleotide reductase, N-terminal domain [48167] (1 superfamily) multihelical consists of two all-alpha subdomains subdomain 1 (residues 10-100) is a 4-helical bundle |
Superfamily a.98.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48168] (1 family) |
Family a.98.1.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48169] (1 protein) |
Protein R1 subunit of ribonucleotide reductase, N-terminal domain [48170] (1 species) |
Species Escherichia coli [TaxId:562] [48171] (8 PDB entries) |
Domain d4r1rc1: 4r1r C:5-221 [18774] Other proteins in same PDB: d4r1ra2, d4r1rb2, d4r1rc2 complexed with gdp, ttp; mutant |
PDB Entry: 4r1r (more details), 3.2 Å
SCOP Domain Sequences for d4r1rc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4r1rc1 a.98.1.1 (C:5-221) R1 subunit of ribonucleotide reductase, N-terminal domain {Escherichia coli} llvtkrdgsterinldkihrvldwaaeglhnvsisqvelrshiqfydgiktsdihetiik aaadlisrdapdyqylaarlaifhlrkkaygqfeppalydhvvkmvemgkydnhlledyt eeefkqmdtfidhdrdmtfsyaavkqlegkylvqnrvtgeiyesaqflyilvaaclfsny pretrlqyvkrfydavstfkislptpimsgvrtptrq
Timeline for d4r1rc1:
View in 3D Domains from other chains: (mouse over for more information) d4r1ra1, d4r1ra2, d4r1rb1, d4r1rb2 |