| Class a: All alpha proteins [46456] (171 folds) |
| Fold a.98: R1 subunit of ribonucleotide reductase, N-terminal domain [48167] (1 superfamily) multihelical consists of two all-alpha subdomains subdomain 1 (residues 10-100) is a 4-helical bundle |
Superfamily a.98.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48168] (1 family) ![]() |
| Family a.98.1.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48169] (1 protein) |
| Protein R1 subunit of ribonucleotide reductase, N-terminal domain [48170] (1 species) |
| Species Escherichia coli [TaxId:562] [48171] (8 PDB entries) |
| Domain d4r1rb1: 4r1r B:5-221 [18773] Other proteins in same PDB: d4r1ra2, d4r1rb2, d4r1rc2 |
PDB Entry: 4r1r (more details), 3.2 Å
SCOP Domain Sequences for d4r1rb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4r1rb1 a.98.1.1 (B:5-221) R1 subunit of ribonucleotide reductase, N-terminal domain {Escherichia coli}
llvtkrdgsterinldkihrvldwaaeglhnvsisqvelrshiqfydgiktsdihetiik
aaadlisrdapdyqylaarlaifhlrkkaygqfeppalydhvvkmvemgkydnhlledyt
eeefkqmdtfidhdrdmtfsyaavkqlegkylvqnrvtgeiyesaqflyilvaaclfsny
pretrlqyvkrfydavstfkislptpimsgvrtptrq
Timeline for d4r1rb1:
View in 3DDomains from other chains: (mouse over for more information) d4r1ra1, d4r1ra2, d4r1rc1, d4r1rc2 |