Lineage for d4r1rb1 (4r1r B:5-221)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 216239Fold a.98: R1 subunit of ribonucleotide reductase, N-terminal domain [48167] (1 superfamily)
    multihelical consists of two all-alpha subdomains
    subdomain 1 (residues 10-100) is a 4-helical bundle
  4. 216240Superfamily a.98.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48168] (1 family) (S)
  5. 216241Family a.98.1.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48169] (1 protein)
  6. 216242Protein R1 subunit of ribonucleotide reductase, N-terminal domain [48170] (1 species)
  7. 216243Species Escherichia coli [TaxId:562] [48171] (8 PDB entries)
  8. 216264Domain d4r1rb1: 4r1r B:5-221 [18773]
    Other proteins in same PDB: d4r1ra2, d4r1rb2, d4r1rc2

Details for d4r1rb1

PDB Entry: 4r1r (more details), 3.2 Å

PDB Description: ribonucleotide reductase r1 protein with substrate, gdp and effector dttp from escherichia coli

SCOP Domain Sequences for d4r1rb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r1rb1 a.98.1.1 (B:5-221) R1 subunit of ribonucleotide reductase, N-terminal domain {Escherichia coli}
llvtkrdgsterinldkihrvldwaaeglhnvsisqvelrshiqfydgiktsdihetiik
aaadlisrdapdyqylaarlaifhlrkkaygqfeppalydhvvkmvemgkydnhlledyt
eeefkqmdtfidhdrdmtfsyaavkqlegkylvqnrvtgeiyesaqflyilvaaclfsny
pretrlqyvkrfydavstfkislptpimsgvrtptrq

SCOP Domain Coordinates for d4r1rb1:

Click to download the PDB-style file with coordinates for d4r1rb1.
(The format of our PDB-style files is described here.)

Timeline for d4r1rb1: