| Class a: All alpha proteins [46456] (151 folds) |
| Fold a.98: R1 subunit of ribonucleotide reductase, N-terminal domain [48167] (1 superfamily) |
Superfamily a.98.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48168] (1 family) ![]() |
| Family a.98.1.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48169] (1 protein) |
| Protein R1 subunit of ribonucleotide reductase, N-terminal domain [48170] (1 species) |
| Species Escherichia coli [TaxId:562] [48171] (8 PDB entries) |
| Domain d2r1rc1: 2r1r C:5-221 [18771] Other proteins in same PDB: d2r1ra2, d2r1rb2, d2r1rc2 |
PDB Entry: 2r1r (more details), 3 Å
SCOP Domain Sequences for d2r1rc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r1rc1 a.98.1.1 (C:5-221) R1 subunit of ribonucleotide reductase, N-terminal domain {Escherichia coli}
llvtkrdgsterinldkihrvldwaaeglhnvsisqvelrshiqfydgiktsdihetiik
aaadlisrdapdyqylaarlaifhlrkkaygqfeppalydhvvkmvemgkydnhlledyt
eeefkqmdtfidhdrdmtfsyaavkqlegkylvqnrvtgeiyesaqflyilvaaclfsny
pretrlqyvkrfydavstfkislptpimsgvrtptrq
Timeline for d2r1rc1:
View in 3DDomains from other chains: (mouse over for more information) d2r1ra1, d2r1ra2, d2r1rb1, d2r1rb2 |