Lineage for d7r1rc1 (7r1r C:1-221)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 216239Fold a.98: R1 subunit of ribonucleotide reductase, N-terminal domain [48167] (1 superfamily)
    multihelical consists of two all-alpha subdomains
    subdomain 1 (residues 10-100) is a 4-helical bundle
  4. 216240Superfamily a.98.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48168] (1 family) (S)
  5. 216241Family a.98.1.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48169] (1 protein)
  6. 216242Protein R1 subunit of ribonucleotide reductase, N-terminal domain [48170] (1 species)
  7. 216243Species Escherichia coli [TaxId:562] [48171] (8 PDB entries)
  8. 216256Domain d7r1rc1: 7r1r C:1-221 [18765]
    Other proteins in same PDB: d7r1ra2, d7r1rb2, d7r1rc2
    mutant

Details for d7r1rc1

PDB Entry: 7r1r (more details), 3.1 Å

PDB Description: ribonucleotide reductase e441q mutant r1 protein from escherichia coli

SCOP Domain Sequences for d7r1rc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7r1rc1 a.98.1.1 (C:1-221) R1 subunit of ribonucleotide reductase, N-terminal domain {Escherichia coli}
mnqnllvtkrdgsterinldkihrvldwaaeglhnvsisqvelrshiqfydgiktsdihe
tiikaaadlisrdapdyqylaarlaifhlrkkaygqfeppalydhvvkmvemgkydnhll
edyteeefkqmdtfidhdrdmtfsyaavkqlegkylvqnrvtgeiyesaqflyilvaacl
fsnypretrlqyvkrfydavstfkislptpimsgvrtptrq

SCOP Domain Coordinates for d7r1rc1:

Click to download the PDB-style file with coordinates for d7r1rc1.
(The format of our PDB-style files is described here.)

Timeline for d7r1rc1: