SCOP 1.57: Domain d5r1rc1: 5r1r C:1-221

Lineage for d5r1rc1 (5r1r C:1-221)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.98: R1 subunit of ribonucleotide reductase, N-terminal domain [48167] (1 superfamily)

4. Superfamily a.98.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48168] (1 family)

5. Family a.98.1.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48169] (1 protein)

6. Protein R1 subunit of ribonucleotide reductase, N-terminal domain [48170] (1 species)

7. Species Escherichia coli [TaxId:562] [48171] (8 PDB entries)

8. Domain d5r1rc1: 5r1r C:1-221 [18759]
   Other proteins in same PDB: d5r1ra2, d5r1rb2, d5r1rc2

Details for d5r1rc1

PDB Entry: 5r1r, 3.1 Å

PDB Description: ribonucleotide reductase e441a mutant r1 protein from escherichia coli

SCOP Domain Sequences for d5r1rc1:

Sequence; same for both SEQRES and ATOM records:

>d5r1rc1 a.98.1.1 (C:1-221) R1 subunit of ribonucleotide reductase, N-terminal domain {Escherichia coli}
mnqnllvtkrdgsterinldkihrvldwaaeglhnvsisqvelrshiqfydgiktsdihe
tiikaaadlisrdapdyqylaarlaifhlrkkaygqfeppalydhvvkmvemgkydnhll
edyteeefkqmdtfidhdrdmtfsyaavkqlegkylvqnrvtgeiyesaqflyilvaacl
fsnypretrlqyvkrfydavstfkislptpimsgvrtptrq

Timeline for d5r1rc1:

• d5r1rc1 first appeared (with stable ids) in SCOP 1.55
  
• d5r1rc1 appears in SCOP 1.59
  
• d5r1rc1 appears in the current release, SCOPe 2.08