| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.98: R1 subunit of ribonucleotide reductase, N-terminal domain [48167] (1 superfamily) multihelical consists of two all-alpha subdomains subdomain 1 (residues 10-100) is a 4-helical bundle |
Superfamily a.98.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48168] (1 family) ![]() |
| Family a.98.1.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48169] (1 protein) |
| Protein R1 subunit of ribonucleotide reductase, N-terminal domain [48170] (2 species) |
| Species Escherichia coli [TaxId:562] [48171] (10 PDB entries) Uniprot Q08698 |
| Domain d5r1rc1: 5r1r C:1-221 [18759] Other proteins in same PDB: d5r1ra2, d5r1rb2, d5r1rc2 mutant |
PDB Entry: 5r1r (more details), 3.1 Å
SCOPe Domain Sequences for d5r1rc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5r1rc1 a.98.1.1 (C:1-221) R1 subunit of ribonucleotide reductase, N-terminal domain {Escherichia coli [TaxId: 562]}
mnqnllvtkrdgsterinldkihrvldwaaeglhnvsisqvelrshiqfydgiktsdihe
tiikaaadlisrdapdyqylaarlaifhlrkkaygqfeppalydhvvkmvemgkydnhll
edyteeefkqmdtfidhdrdmtfsyaavkqlegkylvqnrvtgeiyesaqflyilvaacl
fsnypretrlqyvkrfydavstfkislptpimsgvrtptrq
Timeline for d5r1rc1:
View in 3DDomains from other chains: (mouse over for more information) d5r1ra1, d5r1ra2, d5r1rb1, d5r1rb2 |