Lineage for d1r1rb1 (1r1r B:4-221)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 155154Fold a.98: R1 subunit of ribonucleotide reductase, N-terminal domain [48167] (1 superfamily)
  4. 155155Superfamily a.98.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48168] (1 family) (S)
  5. 155156Family a.98.1.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48169] (1 protein)
  6. 155157Protein R1 subunit of ribonucleotide reductase, N-terminal domain [48170] (1 species)
  7. 155158Species Escherichia coli [TaxId:562] [48171] (8 PDB entries)
  8. 155161Domain d1r1rb1: 1r1r B:4-221 [18755]
    Other proteins in same PDB: d1r1ra2, d1r1rb2, d1r1rc2

Details for d1r1rb1

PDB Entry: 1r1r (more details), 2.9 Å

PDB Description: ribonucleotide reductase r1 protein mutant y730f with a reduced active site from escherichia coli

SCOP Domain Sequences for d1r1rb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r1rb1 a.98.1.1 (B:4-221) R1 subunit of ribonucleotide reductase, N-terminal domain {Escherichia coli}
nllvtkrdgsterinldkihrvldwaaeglhnvsisqvelrshiqfydgiktsdihetii
kaaadlisrdapdyqylaarlaifhlrkkaygqfeppalydhvvkmvemgkydnhlledy
teeefkqmdtfidhdrdmtfsyaavkqlegkylvqnrvtgeiyesaqflyilvaaclfsn
ypretrlqyvkrfydavstfkislptpimsgvrtptrq

SCOP Domain Coordinates for d1r1rb1:

Click to download the PDB-style file with coordinates for d1r1rb1.
(The format of our PDB-style files is described here.)

Timeline for d1r1rb1: