SCOPe 2.08: Domain d1mpga1: 1mpg A:100-282

Lineage for d1mpga1 (1mpg A:100-282)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.96: DNA-glycosylase [48149] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.96.1: DNA-glycosylase [48150] (7 families)

5. Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (3 proteins)

6. Protein 3-Methyladenine DNA glycosylase II (gene alkA or aidA) [48158] (1 species)

7. Species Escherichia coli [TaxId:562] [48159] (11 PDB entries)
   Uniprot P04395

8. Domain d1mpga1: 1mpg A:100-282 [18747]
   Other proteins in same PDB: d1mpga2, d1mpgb2
   complexed with gol

Details for d1mpga1

PDB Entry: 1mpg, 1.8 Å

PDB Description: 3-methyladenine dna glycosylase ii from escherichia coli

PDB Compounds: (A:) 3-methyladenine DNA glycosylase II

SCOPe Domain Sequences for d1mpga1:

Sequence; same for both SEQRES and ATOM records:

>d1mpga1 a.96.1.3 (A:100-282) 3-Methyladenine DNA glycosylase II (gene alkA or aidA) {Escherichia coli [TaxId: 562]}
aarpglrlpgcvdafeqgvrailgqlvsvamaakltarvaqlygerlddfpeyicfptpq
rlaaadpqalkalgmplkraealihlanaalegtlpmtipgdveqamktlqtfpgigrwt
anyfalrgwqakdvflpddylikqrfpgmtpaqirryaerwkpwrsyallhiwytegwqp
dea

Timeline for d1mpga1:

• d1mpga1 first appeared (with stable ids) in SCOP 1.55
  
• d1mpga1 appears in SCOPe 2.07