![]() | Class a: All alpha proteins [46456] (202 folds) |
![]() | Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily) multihelical; consists of two all-alpha domains |
![]() | Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families) ![]() |
![]() | Family a.93.1.1: CCP-like [48114] (4 proteins) |
![]() | Protein Plant peroxidase [48125] (6 species) |
![]() | Species Mouse-ear cress (Arabidopsis thaliana), peroxidase A2 [TaxId:3702] [48131] (2 PDB entries) |
![]() | Domain d1pa2a_: 1pa2 A: [18693] complexed with ca, hem, mg |
PDB Entry: 1pa2 (more details), 1.45 Å
SCOP Domain Sequences for d1pa2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pa2a_ a.93.1.1 (A:) Plant peroxidase {Mouse-ear cress (Arabidopsis thaliana), peroxidase A2} mqlnatfysgtcpnasaivrstiqqalqsdtrigaslirlhfhdcfvngcdasillddtg siqseknagpnvnsargfnvvdniktalenacpgvvscsdvlalaseasvslaggpswtv llgrrdsltanlaganssipspieslsnitfkfsavglntndlvalsgahtfgrarcgvf nnrlfnfsgtgnpdptlnstllstlqqlcpqngsastitnldlstpdafdnnyfanlqsn dgllqsdqelfsttgsstiaivtsfasnqtlffqafaqsminmgnispltgsngeirldc kkvngs
Timeline for d1pa2a_: